"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G8JUM1"	"{'domain_architectures': 24356, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 24356}"	"['Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. In the TIM22 complex, it constitutes the voltage-activated and signal-gated channel. Forms a twin-pore translocase that uses the membrane potential as external driving force in 2 voltage-dependent steps']"	"Ecym_6430"	"[{'identifier': 'GO:0045039', 'name': 'protein insertion into mitochondrial inner membrane', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0042721', 'name': 'TIM22 mitochondrial import inner membrane insertion complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G8JUM1_ERECY"	"d248dad29de54a4a0cf8922bb2c3f57bcdeaa5f8"	True	False	False	201	"Mitochondrial import inner membrane translocase subunit TIM22"	3	"UP000006790"	"MVYRGFGLEHISPPVNKPFNEMTPDEQGERGAQMMVDFMTSCPGKSIISGVTGFALGGIFGMFMASMAYDTPLHTPSPANLGPGAGIPGVQTIQQMADLPLKQQIKIQFTDMGKRAYSSAKNFGYIGMIYSGVECAVESLRAKNDIYNGVAAGCLTGGGLAYKSGPSAALIGCAGFAAFSTAIDLYMRHENGVPPKDDFNE"	"unreviewed"	"{'taxId': '931890', 'scientificName': 'Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582)', 'fullName': 'Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) (Yeast)'}"