General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G8BSW9",
        "id": "G8BSW9_TETPH",
        "source_organism": {
            "taxId": "1071381",
            "scientificName": "Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5)",
            "fullName": "Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) (Yeast)"
        },
        "name": "Uncharacterized protein",
        "description": [
            "Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum"
        ],
        "length": 77,
        "sequence": "MAVDVPRSVITKLMFFTAAMVVCPLVTFFTIQQYTSNTLVSGGLAAAMANVVLIGYIIIAFMEDTASDEELTIKKKE",
        "proteome": "UP000005666",
        "gene": "TPHA0D03040",
        "go_terms": [
            {
                "identifier": "GO:0070072",
                "name": "vacuolar proton-transporting V-type ATPase complex assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "179986e03afdcbedde8c358346371e5bb95ab699",
        "counters": {
            "domain_architectures": 3865,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "hamap": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3865
        }
    }
}