"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G8BSW9"	"{'domain_architectures': 3865, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'hamap': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3865}"	"['Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum']"	"TPHA0D03040"	"[{'identifier': 'GO:0070072', 'name': 'vacuolar proton-transporting V-type ATPase complex assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G8BSW9_TETPH"	"179986e03afdcbedde8c358346371e5bb95ab699"	True	False	False	77	"Uncharacterized protein"	3	"UP000005666"	"MAVDVPRSVITKLMFFTAAMVVCPLVTFFTIQQYTSNTLVSGGLAAAMANVVLIGYIIIAFMEDTASDEELTIKKKE"	"unreviewed"	"{'taxId': '1071381', 'scientificName': 'Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5)', 'fullName': 'Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) (Yeast)'}"