General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G7PWL2",
        "id": "G7PWL2_MACFA",
        "source_organism": {
            "taxId": "9541",
            "scientificName": "Macaca fascicularis",
            "fullName": "Macaca fascicularis (Crab-eating macaque)"
        },
        "name": "E3 ubiquitin-protein ligase RNF125",
        "description": [
            "E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins, such as RIGI, MAVS/IPS1, IFIH1/MDA5, JAK1 and p53/TP53. Acts as a negative regulator of type I interferon production by mediating ubiquitination of RIGI at 'Lys-181', leading to RIGI degradation. Mediates ubiquitination and subsequent degradation of p53/TP53. Mediates ubiquitination and subsequent degradation of JAK1. Acts as a positive regulator of T-cell activation"
        ],
        "length": 232,
        "sequence": "MGSVLSSDSGKSAPPSATPRALERRGDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELDEDSLLDHCITHHRSERRPVFCPLCRLITDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNQSNAT",
        "proteome": "UP000233100",
        "gene": "RNF138",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f029502805c8916978baf2e3949c1bd163b78c6e",
        "counters": {
            "domain_architectures": 1136,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "smart": 1,
                "pfam": 3,
                "profile": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1136
        }
    }
}