"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G7PWL2"	"{'domain_architectures': 1136, 'entries': 17, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'smart': 1, 'pfam': 3, 'profile': 2, 'panther': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1136}"	"[""E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins, such as RIGI, MAVS/IPS1, IFIH1/MDA5, JAK1 and p53/TP53. Acts as a negative regulator of type I interferon production by mediating ubiquitination of RIGI at 'Lys-181', leading to RIGI degradation. Mediates ubiquitination and subsequent degradation of p53/TP53. Mediates ubiquitination and subsequent degradation of JAK1. Acts as a positive regulator of T-cell activation""]"	"RNF138"	""	"G7PWL2_MACFA"	"f029502805c8916978baf2e3949c1bd163b78c6e"	True	False	False	232	"E3 ubiquitin-protein ligase RNF125"	4	"UP000233100"	"MGSVLSSDSGKSAPPSATPRALERRGDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELDEDSLLDHCITHHRSERRPVFCPLCRLITDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNQSNAT"	"unreviewed"	"{'taxId': '9541', 'scientificName': 'Macaca fascicularis', 'fullName': 'Macaca fascicularis (Crab-eating macaque)'}"