GET /api/protein/UniProt/G7MHU6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G7MHU6",
"id": "G7MHU6_MACMU",
"source_organism": {
"taxId": "9544",
"scientificName": "Macaca mulatta",
"fullName": "Macaca mulatta (Rhesus macaque)"
},
"name": "LIM domain transcription factor LMO4",
"description": [
"Transcription cofactor. Plays a role in establishing motor neuron identity, in concert with MNX1, acting, at least in part, to disrupt LDB1-LHX3 complexes thereby negatively modulating interneuron genes in motor neurons"
],
"length": 165,
"sequence": "MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVN",
"proteome": null,
"gene": "EGK_00938",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ef2d731db6a1b8f96953a4ec09c9bfdcbe4db090",
"counters": {
"domain_architectures": 21131,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"profile": 1,
"smart": 1,
"cdd": 2,
"pfam": 1,
"cathgene3d": 1,
"panther": 1,
"prosite": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 21131
}
}
}