"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G7MHU6"	"{'domain_architectures': 21131, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'profile': 1, 'smart': 1, 'cdd': 2, 'pfam': 1, 'cathgene3d': 1, 'panther': 1, 'prosite': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 21131}"	"['Transcription cofactor. Plays a role in establishing motor neuron identity, in concert with MNX1, acting, at least in part, to disrupt LDB1-LHX3 complexes thereby negatively modulating interneuron genes in motor neurons']"	"EGK_00938"	""	"G7MHU6_MACMU"	"ef2d731db6a1b8f96953a4ec09c9bfdcbe4db090"	True	False	True	165	"LIM domain transcription factor LMO4"	4	""	"MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVN"	"unreviewed"	"{'taxId': '9544', 'scientificName': 'Macaca mulatta', 'fullName': 'Macaca mulatta (Rhesus macaque)'}"