HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G5J5C1",
"id": "G5J5C1_CROWT",
"source_organism": {
"taxId": "423471",
"scientificName": "Crocosphaera watsonii WH 0003",
"fullName": "Crocosphaera watsonii WH 0003"
},
"name": "tRNA-specific adenosine deaminase",
"description": [
"Catalyzes the deamination of adenosine to inosine at the wobble position 34 of tRNA(Arg2)"
],
"length": 165,
"sequence": "MKDYFLENYETHCYWMKQALNLGQEAAKAGDVPVGAVIIDSQGKLIAQGLNCKEQNHDPTAHAEIIAIRQATQKLHSWYLNKCTLYVTLEPCIMCAGAIIHSRLGLLVYGVDDPKSGTIRSVLNLPDSAASNHRLSVLSGILEAECRQQLQDWFKQKRNMNIKEQ",
"proteome": null,
"gene": "tadA",
"go_terms": [
{
"identifier": "GO:0008251",
"name": "tRNA-specific adenosine deaminase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0002100",
"name": "tRNA wobble adenosine to inosine editing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bc592f48fd7c6dd1c1f8befbb29bcba2fde72392",
"counters": {
"domain_architectures": 8650,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"hamap": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 8650
}
}
}