"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G5J5C1"	"{'domain_architectures': 8650, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'cdd': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'hamap': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 8650}"	"['Catalyzes the deamination of adenosine to inosine at the wobble position 34 of tRNA(Arg2)']"	"tadA"	"[{'identifier': 'GO:0008251', 'name': 'tRNA-specific adenosine deaminase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0002100', 'name': 'tRNA wobble adenosine to inosine editing', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016787', 'name': 'hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"G5J5C1_CROWT"	"bc592f48fd7c6dd1c1f8befbb29bcba2fde72392"	True	False	False	165	"tRNA-specific adenosine deaminase"	3	""	"MKDYFLENYETHCYWMKQALNLGQEAAKAGDVPVGAVIIDSQGKLIAQGLNCKEQNHDPTAHAEIIAIRQATQKLHSWYLNKCTLYVTLEPCIMCAGAIIHSRLGLLVYGVDDPKSGTIRSVLNLPDSAASNHRLSVLSGILEAECRQQLQDWFKQKRNMNIKEQ"	"unreviewed"	"{'taxId': '423471', 'scientificName': 'Crocosphaera watsonii WH 0003', 'fullName': 'Crocosphaera watsonii WH 0003'}"
