HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3VIP1",
"id": "G3VIP1_SARHA",
"source_organism": {
"taxId": "9305",
"scientificName": "Sarcophilus harrisii",
"fullName": "Sarcophilus harrisii (Tasmanian devil)"
},
"name": "Molybdopterin synthase catalytic subunit",
"description": [
"Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group"
],
"length": 188,
"sequence": "MSSLEISSSSCSQVTRLQLFPPLAEDNISGLLGESMSAIEEKPKDIIKFTLEKLSVDEVSQLVVSPVCGAVSLFVGTTRNNFEGKKVVSLEYEAYMPMAEAEVRKICSAVRQQWPVRHIAVYHRLGLVPVTEASVVIALSSAHRAASLEAVKYVIDTLKAKVPIWKKEIYEEETSSWKRNKECFWTKN",
"proteome": "UP000007648",
"gene": "MOCS2",
"go_terms": [
{
"identifier": "GO:0006777",
"name": "Mo-molybdopterin cofactor biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030366",
"name": "molybdopterin synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005829",
"name": "cytosol",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:1990140",
"name": "molybdopterin synthase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7f26b4bd64731bfa3b72046b085fc9409bd2447d",
"counters": {
"domain_architectures": 21975,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 21975
}
}
}