"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G3VIP1"	"{'domain_architectures': 21975, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'panther': 1, 'hamap': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 21975}"	"['Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group']"	"MOCS2"	"[{'identifier': 'GO:0006777', 'name': 'Mo-molybdopterin cofactor biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030366', 'name': 'molybdopterin synthase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005829', 'name': 'cytosol', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:1990140', 'name': 'molybdopterin synthase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G3VIP1_SARHA"	"7f26b4bd64731bfa3b72046b085fc9409bd2447d"	True	False	False	188	"Molybdopterin synthase catalytic subunit"	3	"UP000007648"	"MSSLEISSSSCSQVTRLQLFPPLAEDNISGLLGESMSAIEEKPKDIIKFTLEKLSVDEVSQLVVSPVCGAVSLFVGTTRNNFEGKKVVSLEYEAYMPMAEAEVRKICSAVRQQWPVRHIAVYHRLGLVPVTEASVVIALSSAHRAASLEAVKYVIDTLKAKVPIWKKEIYEEETSSWKRNKECFWTKN"	"unreviewed"	"{'taxId': '9305', 'scientificName': 'Sarcophilus harrisii', 'fullName': 'Sarcophilus harrisii (Tasmanian devil)'}"