GET /api/protein/UniProt/G3T117/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3T117",
"id": "G3T117_LOXAF",
"source_organism": {
"taxId": "9785",
"scientificName": "Loxodonta africana",
"fullName": "Loxodonta africana (African elephant)"
},
"name": "2-amino-3-carboxymuconate-6-semialdehyde decarboxylase",
"description": [
"Converts alpha-amino-beta-carboxymuconate-epsilon-semialdehyde (ACMS) to alpha-aminomuconate semialdehyde (AMS). ACMS can be converted non-enzymatically to quinolate (QA), a key precursor of NAD, and a potent endogenous excitotoxin of neuronal cells which is implicated in the pathogenesis of various neurodegenerative disorders. In the presence of ACMSD, ACMS is converted to AMS, a benign catabolite. ACMSD ultimately controls the metabolic fate of tryptophan catabolism along the kynurenine pathway"
],
"length": 336,
"sequence": "MKIDIHSHILPKEWPDLNKRFGYGGWVQLQHHNKGEAKMLKDGKVFRVVQENCWDPDVRIREMDQTGVTVQALSTVPVMFSYWAKPLDTLDLCQLLNNDLAATVACHPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGSHVNEWDLNAQELFPVYAAAERLNCSLLVHPWDMQMDGRMAKYWLPWLVGMPAETTMAICSMIMGGVFTKFPKLKVCFAHGGGAFPFTLGRISHGFSMRPDLCAQDNPTNPKKYLGSFYTDSLVHDPLALKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEAFDEETKDKLKAGNALAFLGLERKQFE",
"proteome": "UP000007646",
"gene": "ACMSD",
"go_terms": [
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016831",
"name": "carboxy-lyase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "893f5bb5f82dba8c120faf41d4a977fe8fba5622",
"counters": {
"domain_architectures": 79182,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 79182
}
}
}