General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3RZL4",
        "id": "G3RZL4_GORGO",
        "source_organism": {
            "taxId": "9595",
            "scientificName": "Gorilla gorilla gorilla",
            "fullName": "Gorilla gorilla gorilla (Western lowland gorilla)"
        },
        "name": "Prokineticin-2",
        "description": [
            "May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle"
        ],
        "length": 129,
        "sequence": "MRSLCCAPLLLLLLLPPLLLTPRSGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK",
        "proteome": "UP000001519",
        "gene": "PROK2",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0af9bd39c9041155d0c74c821c308a84601bf533",
        "counters": {
            "domain_architectures": 1935,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1935
        }
    }
}