"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G3RZL4"	"{'domain_architectures': 1935, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1935}"	"['May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle']"	"PROK2"	""	"G3RZL4_GORGO"	"0af9bd39c9041155d0c74c821c308a84601bf533"	True	False	False	129	"Prokineticin-2"	3	"UP000001519"	"MRSLCCAPLLLLLLLPPLLLTPRSGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK"	"unreviewed"	"{'taxId': '9595', 'scientificName': 'Gorilla gorilla gorilla', 'fullName': 'Gorilla gorilla gorilla (Western lowland gorilla)'}"
