GET /api/protein/UniProt/G3NZP1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3NZP1",
"id": "G3NZP1_GASAC",
"source_organism": {
"taxId": "481459",
"scientificName": "Gasterosteus aculeatus aculeatus",
"fullName": "Gasterosteus aculeatus aculeatus (three-spined stickleback)"
},
"name": "Secreted frizzled-related protein 3",
"description": [
"Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP3/FRZB appears to be involved in limb skeletogenesis. Antagonist of Wnt8 signaling. Regulates chondrocyte maturation and long bone development"
],
"length": 313,
"sequence": "MLSPGLCVSLLAASCALWPAAAVRAASCESVRIPLCASMPWNMTKMPNHLHHSTQDNAVLAIEQYEGLLGTGCSPDLLFFLCAMYAPICTIDFQHEPIKPCKAVCERAKQGCEPVMKRYNHSWPDSLACSELPLYDRGVCISPEAIVKAEAPDPYPQDPARCNPESSPDFPMDSNNLHCRGPNADRCKCKTVKMGFKNYQRNNYNYVIRARVREVRNRGLEPTAVVEVKEVLKSSLVNIPKETQTLYYSSSCLCPPLSPGEEYLIMGYENDEMSRLLLIDGSIAQKWREKMSRKIKLHSVTLSVAPFLHLATA",
"proteome": "UP000007635",
"gene": null,
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f8a655922328c0c2a242c85dc64e70c2a18e5657",
"counters": {
"domain_architectures": 3784,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 2,
"cathgene3d": 2,
"ssf": 2,
"smart": 2,
"pfam": 2,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3784
}
}
}