General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3LH89",
        "id": "VKT_BOMIG",
        "source_organism": {
            "taxId": "130704",
            "scientificName": "Bombus ignitus",
            "fullName": "Bombus ignitus (Bumblebee)"
        },
        "name": "Kunitz-type serine protease inhibitor Bi-KTI",
        "description": [
            "Serine protease inhibitor that inhibits plasmin (IC(50)=43.53 nM, Ki=3.6 nM), thereby acting as an antifibrinolytic agent. May act in a cooperative manner with the serine protease Bi-VSP (AC B5U2W0) to promote the spread of bee venom under anti-bleeding conditions"
        ],
        "length": 82,
        "sequence": "MNHKFIALLLVVLCCALAVHQVSAEVPSHCTLSLATGTCKGYFPRFGYNIEMGKCVEFIYGGCDGNANNFRNLEECQQSCSV",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0004867",
                "name": "serine-type endopeptidase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "48157877623340d97a82db41d1be13a48a535250",
        "counters": {
            "domain_architectures": 9087,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 9087
        }
    }
}