"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G3LH89"	"{'domain_architectures': 9087, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 9087}"	"['Serine protease inhibitor that inhibits plasmin (IC(50)=43.53 nM, Ki=3.6 nM), thereby acting as an antifibrinolytic agent. May act in a cooperative manner with the serine protease Bi-VSP (AC B5U2W0) to promote the spread of bee venom under anti-bleeding conditions']"	""	"[{'identifier': 'GO:0004867', 'name': 'serine-type endopeptidase inhibitor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"VKT_BOMIG"	"48157877623340d97a82db41d1be13a48a535250"	True	False	False	82	"Kunitz-type serine protease inhibitor Bi-KTI"	3	""	"MNHKFIALLLVVLCCALAVHQVSAEVPSHCTLSLATGTCKGYFPRFGYNIEMGKCVEFIYGGCDGNANNFRNLEECQQSCSV"	"reviewed"	"{'taxId': '130704', 'scientificName': 'Bombus ignitus', 'fullName': 'Bombus ignitus (Bumblebee)'}"