GET /api/protein/UniProt/G3I3T6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3I3T6",
"id": "G3I3T6_CRIGR",
"source_organism": {
"taxId": "10029",
"scientificName": "Cricetulus griseus",
"fullName": "Cricetulus griseus (Chinese hamster)"
},
"name": "GINS complex subunit 2",
"description": [
"Required for correct functioning of the GINS complex, a complex that plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex is a core component of CDC45-MCM-GINS (CMG) helicase, the molecular machine that unwinds template DNA during replication, and around which the replisome is built"
],
"length": 188,
"sequence": "MDAAEVEFLAKKELVTIIPNFSLDKIYLIGGDLGPFNLAYPWKCPFGWPINLKQRQKCCLLPPEWMDVEKMEQIQDQERKEETFTPVPSPHYMEITKLLLNHASDNISKADTIRTLIKDLWDTRMAKLRVSADNFVWQQEAHAKLDNLTNRHMDQCNQIKNPEINPQTYEHLIFDKEAKLAQATTFLI",
"proteome": null,
"gene": "I79_018104",
"go_terms": [
{
"identifier": "GO:0006260",
"name": "DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4c0019bcdf61d06f0b9219e0c18fccd30d1808ee",
"counters": {
"domain_architectures": 3547,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"cdd": 2,
"pfam": 2,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3547
}
}
}