"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G3I3T6"	"{'domain_architectures': 3547, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 2, 'cdd': 2, 'pfam': 2, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3547}"	"['Required for correct functioning of the GINS complex, a complex that plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex is a core component of CDC45-MCM-GINS (CMG) helicase, the molecular machine that unwinds template DNA during replication, and around which the replisome is built']"	"I79_018104"	"[{'identifier': 'GO:0006260', 'name': 'DNA replication', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005634', 'name': 'nucleus', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G3I3T6_CRIGR"	"4c0019bcdf61d06f0b9219e0c18fccd30d1808ee"	True	False	False	188	"GINS complex subunit 2"	3	""	"MDAAEVEFLAKKELVTIIPNFSLDKIYLIGGDLGPFNLAYPWKCPFGWPINLKQRQKCCLLPPEWMDVEKMEQIQDQERKEETFTPVPSPHYMEITKLLLNHASDNISKADTIRTLIKDLWDTRMAKLRVSADNFVWQQEAHAKLDNLTNRHMDQCNQIKNPEINPQTYEHLIFDKEAKLAQATTFLI"	"unreviewed"	"{'taxId': '10029', 'scientificName': 'Cricetulus griseus', 'fullName': 'Cricetulus griseus (Chinese hamster)'}"