GET /api/protein/UniProt/G3HVU9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3HVU9",
        "id": "G3HVU9_CRIGR",
        "source_organism": {
            "taxId": "10029",
            "scientificName": "Cricetulus griseus",
            "fullName": "Cricetulus griseus (Chinese hamster)"
        },
        "name": "E3 ubiquitin-protein ligase PPP1R11",
        "description": [
            "Atypical E3 ubiquitin-protein ligase which ubiquitinates TLR2 at 'Lys-754' leading to its degradation by the proteasome. Plays a role in regulating inflammatory cytokine release and gram-positive bacterial clearance by functioning, in part, through the ubiquitination and degradation of TLR2. Inhibitor of protein phosphatase 1"
        ],
        "length": 126,
        "sequence": "MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESEEDEEEGCGHTHCVRGHRKGRRHSTPGPTPTTPPQPPDPSQPPPGPMQH",
        "proteome": "UP001108280",
        "gene": "Ppp1r11",
        "go_terms": [
            {
                "identifier": "GO:0004865",
                "name": "protein serine/threonine phosphatase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ad1dc68d26dcd895052b0b779c65d3d2b59110c7",
        "counters": {
            "domain_architectures": 3700,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3700
        }
    }
}