"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G3HVU9"	"{'domain_architectures': 3700, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3700}"	"[""Atypical E3 ubiquitin-protein ligase which ubiquitinates TLR2 at 'Lys-754' leading to its degradation by the proteasome. Plays a role in regulating inflammatory cytokine release and gram-positive bacterial clearance by functioning, in part, through the ubiquitination and degradation of TLR2. Inhibitor of protein phosphatase 1""]"	"Ppp1r11"	"[{'identifier': 'GO:0004865', 'name': 'protein serine/threonine phosphatase inhibitor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"G3HVU9_CRIGR"	"ad1dc68d26dcd895052b0b779c65d3d2b59110c7"	True	False	False	126	"E3 ubiquitin-protein ligase PPP1R11"	4	"UP001108280"	"MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESEEDEEEGCGHTHCVRGHRKGRRHSTPGPTPTTPPQPPDPSQPPPGPMQH"	"unreviewed"	"{'taxId': '10029', 'scientificName': 'Cricetulus griseus', 'fullName': 'Cricetulus griseus (Chinese hamster)'}"