GET /api/protein/UniProt/G3GY69/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3GY69",
        "id": "G3GY69_CRIGR",
        "source_organism": {
            "taxId": "10029",
            "scientificName": "Cricetulus griseus",
            "fullName": "Cricetulus griseus (Chinese hamster)"
        },
        "name": "Sex hormone-binding globulin",
        "description": [
            "Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration",
            "Mediates cell adhesion of neurons and astrocytes, and promotes neurite outgrowth",
            "This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-2 subunit is not known"
        ],
        "length": 436,
        "sequence": "MLLKHKGEVCLPRPYSSFEFRTLDPEGVIFYGDTNTKDDWFMLGLRDGQLETQLHNFWARLTVGFGPQLNDGRWHQVELKMYGDSLQLRVDGKELLCLRQVSGSLADNSQPSMRIALGGLLLPTSSLRFPLVPALDGCIRRDIWLGHQAPLSTSAPSNLGNCDVDLQPGLFFPPGTHAEFSLQAFILLFYLVCDGFLTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMICPKTQNLDVIVNISDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDPTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCVGKRDEDAENLGHFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT",
        "proteome": null,
        "gene": "I79_002740",
        "go_terms": [
            {
                "identifier": "GO:0006813",
                "name": "potassium ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006814",
                "name": "sodium ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005890",
                "name": "sodium:potassium-exchanging ATPase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c5afe46c87bdca9d31be15fe96c6d6788974af9a",
        "counters": {
            "domain_architectures": 2,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "smart": 1,
                "ssf": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2
        }
    }
}