"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G3GY69"	"{'domain_architectures': 2, 'entries': 15, 'isoforms': 0, 'proteomes': 0, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'smart': 1, 'ssf': 1, 'cathgene3d': 2, 'cdd': 1, 'pfam': 2, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 2}"	"['Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration', 'Mediates cell adhesion of neurons and astrocytes, and promotes neurite outgrowth', 'This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-2 subunit is not known']"	"I79_002740"	"[{'identifier': 'GO:0006813', 'name': 'potassium ion transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006814', 'name': 'sodium ion transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005890', 'name': 'sodium:potassium-exchanging ATPase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G3GY69_CRIGR"	"c5afe46c87bdca9d31be15fe96c6d6788974af9a"	True	False	False	436	"Sex hormone-binding globulin"	3	""	"MLLKHKGEVCLPRPYSSFEFRTLDPEGVIFYGDTNTKDDWFMLGLRDGQLETQLHNFWARLTVGFGPQLNDGRWHQVELKMYGDSLQLRVDGKELLCLRQVSGSLADNSQPSMRIALGGLLLPTSSLRFPLVPALDGCIRRDIWLGHQAPLSTSAPSNLGNCDVDLQPGLFFPPGTHAEFSLQAFILLFYLVCDGFLTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMICPKTQNLDVIVNISDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDPTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCVGKRDEDAENLGHFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT"	"unreviewed"	"{'taxId': '10029', 'scientificName': 'Cricetulus griseus', 'fullName': 'Cricetulus griseus (Chinese hamster)'}"