GET /api/protein/UniProt/G2XIW5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G2XIW5",
"id": "G2XIW5_VERDV",
"source_organism": {
"taxId": "498257",
"scientificName": "Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137)",
"fullName": "Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)"
},
"name": "Peroxisomal membrane protein PEX14",
"description": [
"Component of the PEX13-PEX14 docking complex, a translocon channel that specifically mediates the import of peroxisomal cargo proteins bound to PEX5 receptor. The PEX13-PEX14 docking complex forms a large import pore which can be opened to a diameter of about 9 nm. Mechanistically, PEX5 receptor along with cargo proteins associates with the PEX14 subunit of the PEX13-PEX14 docking complex in the cytosol, leading to the insertion of the receptor into the organelle membrane with the concomitant translocation of the cargo into the peroxisome matrix"
],
"length": 294,
"sequence": "MGSPYQNSPQQYYGQPYAPQHAAWQPPPPPPKRDWRDWFIMATVVGGVSYGVYELTKRYVYPLIAPPTPERLEQDKKTIEEQFDGAFALVEQLAKDTEALKAAEQERTERLDTALSDFEGVINELKSANKRRDDEAQRIRDDVYNLKDAIPKALETQKDLTDQRLREINAELTSLKTLISQRMTAPSPSPTPVNGYLRPNNSTSGTPATPSGNKSASVADEKPSPEPTTPSSTEPAKPNNFSSAGKSLALGGSGAKASIPAWQMAMANKSTNSSSAASSGDAAGASQAQAGGSA",
"proteome": "UP000001611",
"gene": "VDAG_10088",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016560",
"name": "protein import into peroxisome matrix, docking",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005778",
"name": "peroxisomal membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 2,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1
}
}
}