"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G2XIW5"	"{'domain_architectures': 0, 'entries': 2, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1}"	"['Component of the PEX13-PEX14 docking complex, a translocon channel that specifically mediates the import of peroxisomal cargo proteins bound to PEX5 receptor. The PEX13-PEX14 docking complex forms a large import pore which can be opened to a diameter of about 9 nm. Mechanistically, PEX5 receptor along with cargo proteins associates with the PEX14 subunit of the PEX13-PEX14 docking complex in the cytosol, leading to the insertion of the receptor into the organelle membrane with the concomitant translocation of the cargo into the peroxisome matrix']"	"VDAG_10088"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016560', 'name': 'protein import into peroxisome matrix, docking', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005778', 'name': 'peroxisomal membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G2XIW5_VERDV"	""	True	False	False	294	"Peroxisomal membrane protein PEX14"	3	"UP000001611"	"MGSPYQNSPQQYYGQPYAPQHAAWQPPPPPPKRDWRDWFIMATVVGGVSYGVYELTKRYVYPLIAPPTPERLEQDKKTIEEQFDGAFALVEQLAKDTEALKAAEQERTERLDTALSDFEGVINELKSANKRRDDEAQRIRDDVYNLKDAIPKALETQKDLTDQRLREINAELTSLKTLISQRMTAPSPSPTPVNGYLRPNNSTSGTPATPSGNKSASVADEKPSPEPTTPSSTEPAKPNNFSSAGKSLALGGSGAKASIPAWQMAMANKSTNSSSAASSGDAAGASQAQAGGSA"	"unreviewed"	"{'taxId': '498257', 'scientificName': 'Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137)', 'fullName': 'Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)'}"
