GET /api/protein/UniProt/G2T5N4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G2T5N4",
        "id": "G2T5N4_ROSHA",
        "source_organism": {
            "taxId": "585394",
            "scientificName": "Roseburia hominis (strain DSM 16839 / JCM 17582 / NCIMB 14029 / A2-183)",
            "fullName": "Roseburia hominis (strain DSM 16839 / JCM 17582 / NCIMB 14029 / A2-183)"
        },
        "name": "Small ribosomal subunit protein uS10",
        "description": [
            "Involved in the binding of tRNA to the ribosomes"
        ],
        "length": 105,
        "sequence": "MASQVMRITLKAYDHKLVDSSAQKIIETVKKNGSQVSGPVPLPTKKEVVTILRATHKYKDSREQFEQRTHKRLIDIVTPTQKTVDALSRLEMPAGVYIDIKMKNK",
        "proteome": "UP000008178",
        "gene": "rpsJ",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "86d25d2336a078f2093c0d54f0060f7f4367804d",
        "counters": {
            "domain_architectures": 37700,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 37700
        }
    }
}