"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G2T5N4"	"{'domain_architectures': 37700, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'ncbifam': 2, 'hamap': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 37700}"	"['Involved in the binding of tRNA to the ribosomes']"	"rpsJ"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"G2T5N4_ROSHA"	"86d25d2336a078f2093c0d54f0060f7f4367804d"	True	False	False	105	"Small ribosomal subunit protein uS10"	3	"UP000008178"	"MASQVMRITLKAYDHKLVDSSAQKIIETVKKNGSQVSGPVPLPTKKEVVTILRATHKYKDSREQFEQRTHKRLIDIVTPTQKTVDALSRLEMPAGVYIDIKMKNK"	"unreviewed"	"{'taxId': '585394', 'scientificName': 'Roseburia hominis (strain DSM 16839 / JCM 17582 / NCIMB 14029 / A2-183)', 'fullName': 'Roseburia hominis (strain DSM 16839 / JCM 17582 / NCIMB 14029 / A2-183)'}"
