GET /api/protein/UniProt/G2T4D3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G2T4D3",
        "id": "G2T4D3_ROSHA",
        "source_organism": {
            "taxId": "585394",
            "scientificName": "Roseburia hominis (strain DSM 16839 / JCM 17582 / NCIMB 14029 / A2-183)",
            "fullName": "Roseburia hominis (strain DSM 16839 / JCM 17582 / NCIMB 14029 / A2-183)"
        },
        "name": "Putative septation protein SpoVG",
        "description": [
            "Could be involved in septation"
        ],
        "length": 88,
        "sequence": "MQITDVRIRKVEKEGKMKAVVSITIDEEFVVHDIKVIEGDKGLFIAMPSRKAADGEYRDIAHPINSDTRERIQTLILQKYQETMAAEE",
        "proteome": "UP000008178",
        "gene": "spoVG",
        "go_terms": [
            {
                "identifier": "GO:0030435",
                "name": "sporulation resulting in formation of a cellular spore",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1b5f076a4fd586f72e02276979f196d31a0ca781",
        "counters": {
            "domain_architectures": 4015,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4015
        }
    }
}