"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G2T4D3"	"{'domain_architectures': 4015, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4015}"	"['Could be involved in septation']"	"spoVG"	"[{'identifier': 'GO:0030435', 'name': 'sporulation resulting in formation of a cellular spore', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G2T4D3_ROSHA"	"1b5f076a4fd586f72e02276979f196d31a0ca781"	True	False	False	88	"Putative septation protein SpoVG"	3	"UP000008178"	"MQITDVRIRKVEKEGKMKAVVSITIDEEFVVHDIKVIEGDKGLFIAMPSRKAADGEYRDIAHPINSDTRERIQTLILQKYQETMAAEE"	"unreviewed"	"{'taxId': '585394', 'scientificName': 'Roseburia hominis (strain DSM 16839 / JCM 17582 / NCIMB 14029 / A2-183)', 'fullName': 'Roseburia hominis (strain DSM 16839 / JCM 17582 / NCIMB 14029 / A2-183)'}"