General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G1SYJ8",
        "id": "G1SYJ8_RABIT",
        "source_organism": {
            "taxId": "9986",
            "scientificName": "Oryctolagus cuniculus",
            "fullName": "Oryctolagus cuniculus (Rabbit)"
        },
        "name": "dCTP pyrophosphatase 1",
        "description": [
            "Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for dCTP and its analogs including 5-iodo-dCTP and 5-methyl-dCTP for which it may even have a higher efficiency. May protect DNA or RNA against the incorporation of these genotoxic nucleotide analogs through their catabolism"
        ],
        "length": 166,
        "sequence": "MSGAGGDTGGEGTAAAGPFSFSPEPTLEDIRRLHAEFAAERDWDQFHQPRNLLLALVGEVGELAELFQWKPDEEPGPQAWPARERAALQEELSDVLIYLVALAARCRVDLPQAVLSKMDTNRRRYPVHLARGSARKYTDFGRGAGSEDQATGAAPLACESPGQGPT",
        "proteome": "UP000001811",
        "gene": "DCTPP1",
        "go_terms": [
            {
                "identifier": "GO:0047429",
                "name": "nucleoside triphosphate diphosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009143",
                "name": "nucleoside triphosphate catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ec93eb7b1b455d5f864dd21ebd6d09bf20d0d3c2",
        "counters": {
            "domain_architectures": 8675,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8675
        }
    }
}