"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G1SYJ8"	"{'domain_architectures': 8675, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 8675}"	"['Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for dCTP and its analogs including 5-iodo-dCTP and 5-methyl-dCTP for which it may even have a higher efficiency. May protect DNA or RNA against the incorporation of these genotoxic nucleotide analogs through their catabolism']"	"DCTPP1"	"[{'identifier': 'GO:0047429', 'name': 'nucleoside triphosphate diphosphatase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009143', 'name': 'nucleoside triphosphate catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G1SYJ8_RABIT"	"ec93eb7b1b455d5f864dd21ebd6d09bf20d0d3c2"	True	False	False	166	"dCTP pyrophosphatase 1"	4	"UP000001811"	"MSGAGGDTGGEGTAAAGPFSFSPEPTLEDIRRLHAEFAAERDWDQFHQPRNLLLALVGEVGELAELFQWKPDEEPGPQAWPARERAALQEELSDVLIYLVALAARCRVDLPQAVLSKMDTNRRRYPVHLARGSARKYTDFGRGAGSEDQATGAAPLACESPGQGPT"	"unreviewed"	"{'taxId': '9986', 'scientificName': 'Oryctolagus cuniculus', 'fullName': 'Oryctolagus cuniculus (Rabbit)'}"