GET /api/protein/UniProt/G0W878/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G0W878",
"id": "G0W878_NAUDC",
"source_organism": {
"taxId": "1071378",
"scientificName": "Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639)",
"fullName": "Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639)"
},
"name": "Mitochondrial pyruvate carrier",
"description": [
"Mediates the uptake of pyruvate into mitochondria"
],
"length": 134,
"sequence": "MSTTTINSAFRRFWQSQTGPKTVHFWAPTLKWGLVIAGLSDINRPVEKVSGAQNLSLLATALIWTRWSFVIKPRNLLLASVNGVLGLTAGYHLLRIVDFRIRNGDSMSQLMKYIINGEQTQKQKHQQTKAITSS",
"proteome": "UP000000689",
"gene": "NDAI0C03290",
"go_terms": [
{
"identifier": "GO:0006850",
"name": "pyruvate import into mitochondria",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005743",
"name": "mitochondrial inner membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e9f0f88d8127232a5397fa766d3dcefa874e3349",
"counters": {
"domain_architectures": 9796,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 9796
}
}
}