"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G0W878"	"{'domain_architectures': 9796, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 9796}"	"['Mediates the uptake of pyruvate into mitochondria']"	"NDAI0C03290"	"[{'identifier': 'GO:0006850', 'name': 'pyruvate import into mitochondria', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005743', 'name': 'mitochondrial inner membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G0W878_NAUDC"	"e9f0f88d8127232a5397fa766d3dcefa874e3349"	True	False	False	134	"Mitochondrial pyruvate carrier"	3	"UP000000689"	"MSTTTINSAFRRFWQSQTGPKTVHFWAPTLKWGLVIAGLSDINRPVEKVSGAQNLSLLATALIWTRWSFVIKPRNLLLASVNGVLGLTAGYHLLRIVDFRIRNGDSMSQLMKYIINGEQTQKQKHQQTKAITSS"	"unreviewed"	"{'taxId': '1071378', 'scientificName': 'Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639)', 'fullName': 'Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639)'}"