General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F9TA84",
        "id": "F9TA84_9VIBR",
        "source_organism": {
            "taxId": "1051646",
            "scientificName": "Vibrio tubiashii ATCC 19109",
            "fullName": "Vibrio tubiashii ATCC 19109"
        },
        "name": "Enterobactin synthase component D",
        "description": [
            "Involved in the biosynthesis of the siderophore enterobactin (enterochelin), which is a macrocyclic trimeric lactone of N-(2,3-dihydroxybenzoyl)-serine. The serine trilactone serves as a scaffolding for the three catechol functionalities that provide hexadentate coordination for the tightly ligated iron(2+) atoms. Plays an essential role in the assembly of the enterobactin by catalyzing the transfer of the 4'-phosphopantetheine (Ppant) moiety from coenzyme A to the apo-domains of both EntB (ArCP domain) and EntF (PCP domain) to yield their holo-forms which make them competent for the activation of 2,3-dihydroxybenzoate (DHB) and L-serine, respectively"
        ],
        "length": 242,
        "sequence": "MDKRLASVTLSKPWLTRCPNYSFSIPERIINICVVKYYVSHFSLDLQLSQWLPLQLRQANHKRQAEFIAGRVAAHYSMNAFDQDQSVEINPDRSPLFPKALQGSISHSRNLAIAATIPSEMIPDTHLGIDIQHWFSSEETDDVAGLVCKDVEIERLQDSHLSYQQKVTLLFSAKEALYKAIYPQVKEVLNFDVVELVDAKNHILYFACSGYLIDMGFPQQLECHYQLHNTHIVTLALSGASN",
        "proteome": "UP000003836",
        "gene": "VITU9109_23945",
        "go_terms": [
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008897",
                "name": "holo-[acyl-carrier-protein] synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016780",
                "name": "phosphotransferase activity, for other substituted phosphate groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009239",
                "name": "enterobactin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009366",
                "name": "enterobactin synthetase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f65074827a79c62af0d20eb9afc8329c3af98dde",
        "counters": {
            "domain_architectures": 7279,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7279
        }
    }
}