"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F9TA84"	"{'domain_architectures': 7279, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7279}"	"[""Involved in the biosynthesis of the siderophore enterobactin (enterochelin), which is a macrocyclic trimeric lactone of N-(2,3-dihydroxybenzoyl)-serine. The serine trilactone serves as a scaffolding for the three catechol functionalities that provide hexadentate coordination for the tightly ligated iron(2+) atoms. Plays an essential role in the assembly of the enterobactin by catalyzing the transfer of the 4'-phosphopantetheine (Ppant) moiety from coenzyme A to the apo-domains of both EntB (ArCP domain) and EntF (PCP domain) to yield their holo-forms which make them competent for the activation of 2,3-dihydroxybenzoate (DHB) and L-serine, respectively""]"	"VITU9109_23945"	"[{'identifier': 'GO:0000287', 'name': 'magnesium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008897', 'name': 'holo-[acyl-carrier-protein] synthase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016780', 'name': 'phosphotransferase activity, for other substituted phosphate groups', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009239', 'name': 'enterobactin biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009366', 'name': 'enterobactin synthetase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"F9TA84_9VIBR"	"f65074827a79c62af0d20eb9afc8329c3af98dde"	True	False	False	242	"Enterobactin synthase component D"	3	"UP000003836"	"MDKRLASVTLSKPWLTRCPNYSFSIPERIINICVVKYYVSHFSLDLQLSQWLPLQLRQANHKRQAEFIAGRVAAHYSMNAFDQDQSVEINPDRSPLFPKALQGSISHSRNLAIAATIPSEMIPDTHLGIDIQHWFSSEETDDVAGLVCKDVEIERLQDSHLSYQQKVTLLFSAKEALYKAIYPQVKEVLNFDVVELVDAKNHILYFACSGYLIDMGFPQQLECHYQLHNTHIVTLALSGASN"	"unreviewed"	"{'taxId': '1051646', 'scientificName': 'Vibrio tubiashii ATCC 19109', 'fullName': 'Vibrio tubiashii ATCC 19109'}"