General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F8H6Y6",
        "id": "F8H6Y6_STUS2",
        "source_organism": {
            "taxId": "96563",
            "scientificName": "Stutzerimonas stutzeri (strain ATCC 17588 / DSM 5190 / CCUG 11256 / JCM 5965 / LMG 11199 / NBRC 14165 / NCIMB 11358 / Stanier 221)",
            "fullName": "Stutzerimonas stutzeri (strain ATCC 17588 / DSM 5190 / CCUG 11256 / JCM 5965 / LMG 11199 / NBRC 14165 / NCIMB 11358 / Stanier 221)"
        },
        "name": "Ubiquinone biosynthesis accessory factor UbiJ",
        "description": [
            "Required for ubiquinone (coenzyme Q) biosynthesis. Binds hydrophobic ubiquinone biosynthetic intermediates via its SCP2 domain and is essential for the stability of the Ubi complex. May constitute a docking platform where Ubi enzymes assemble and access their SCP2-bound polyprenyl substrates"
        ],
        "length": 207,
        "sequence": "MLRAALLAGAERGINRVLRLDPTALPRLARLSGRVIEIDCTAPAWRLFILADDEGLRLAGTWGSDADCRLRAPASSLLRLAASRNKTAVLHGPDVEIEGDSGLLMNLAEVLQDLELDWEYEISRWLGPVGAQLLGSSLRNPLDWLRDSAGSLRQDLADYLSEESRTLVGQAEAQARFDELDDMKLALDRLEARIERLALNLNPDRSE",
        "proteome": null,
        "gene": "ubiJ",
        "go_terms": [
            {
                "identifier": "GO:0006744",
                "name": "ubiquinone biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8eae963894d0644f67b3003a8fcef02ccd4c6f88",
        "counters": {
            "domain_architectures": 22221,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 22221
        }
    }
}