"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F8H6Y6"	"{'domain_architectures': 22221, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'ssf': 1, 'panther': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 22221}"	"['Required for ubiquinone (coenzyme Q) biosynthesis. Binds hydrophobic ubiquinone biosynthetic intermediates via its SCP2 domain and is essential for the stability of the Ubi complex. May constitute a docking platform where Ubi enzymes assemble and access their SCP2-bound polyprenyl substrates']"	"ubiJ"	"[{'identifier': 'GO:0006744', 'name': 'ubiquinone biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"F8H6Y6_STUS2"	"8eae963894d0644f67b3003a8fcef02ccd4c6f88"	True	False	False	207	"Ubiquinone biosynthesis accessory factor UbiJ"	3	""	"MLRAALLAGAERGINRVLRLDPTALPRLARLSGRVIEIDCTAPAWRLFILADDEGLRLAGTWGSDADCRLRAPASSLLRLAASRNKTAVLHGPDVEIEGDSGLLMNLAEVLQDLELDWEYEISRWLGPVGAQLLGSSLRNPLDWLRDSAGSLRQDLADYLSEESRTLVGQAEAQARFDELDDMKLALDRLEARIERLALNLNPDRSE"	"unreviewed"	"{'taxId': '96563', 'scientificName': 'Stutzerimonas stutzeri (strain ATCC 17588 / DSM 5190 / CCUG 11256 / JCM 5965 / LMG 11199 / NBRC 14165 / NCIMB 11358 / Stanier 221)', 'fullName': 'Stutzerimonas stutzeri (strain ATCC 17588 / DSM 5190 / CCUG 11256 / JCM 5965 / LMG 11199 / NBRC 14165 / NCIMB 11358 / Stanier 221)'}"