HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F8ES46",
"id": "F8ES46_ZYMMT",
"source_organism": {
"taxId": "579138",
"scientificName": "Zymomonas mobilis subsp. pomaceae (strain ATCC 29192 / DSM 22645 / JCM 10191 / CCUG 17912 / NBRC 13757 / NCIMB 11200 / NRRL B-4491 / Barker I)",
"fullName": "Zymomonas mobilis subsp. pomaceae (strain ATCC 29192 / DSM 22645 / JCM 10191 / CCUG 17912 / NBRC 13757 / NCIMB 11200 / NRRL B-4491 / Barker I)"
},
"name": "Bifunctional protein GlmU",
"description": [
"Catalyzes the last two sequential reactions in the de novo biosynthetic pathway for UDP-N-acetylglucosamine (UDP-GlcNAc). The C-terminal domain catalyzes the transfer of acetyl group from acetyl coenzyme A to glucosamine-1-phosphate (GlcN-1-P) to produce N-acetylglucosamine-1-phosphate (GlcNAc-1-P), which is converted into UDP-GlcNAc by the transfer of uridine 5-monophosphate (from uridine 5-triphosphate), a reaction catalyzed by the N-terminal domain"
],
"length": 454,
"sequence": "MTTHKPFSAVILAAGKGTRMRSDIHKILHPLAGRPLLGWVLETIAPLEPVYTILVTGSGRNQVERYLEKMSLSVTPVTQNEQLGTAHAVNQAKSALEEFKGDIVILYGDVPLVQPKTIQHLLSRLHQADKPKVAVLAFRPDDPRQYGRILTGENNHIVKMVEYKDANPKERQINLCNSGLLAIRSADLWPLLDRVKNNNAAGEYYLPDIVMLALVDGDVAVTVEAEAWEVTGVNNRSELAQLETVWQTRKRTRVMEEGASLVAPETVWFSYDTKIGRDVTIEPQVFFGPEVKIGDGVTIHAFSHIEGAEVAEKAEIGPFARLRPGADIAEKAKVGNFVEIKKAKVEKGAKVNHLTYIGDASIGAGANIGGGTITCNYDGFGKYRTEIGENAFIGSNSALVAPVRIGAGAIIAAGSIVTCNVPDDALAIARGRQENKSLWAKAFRAHKSKDKAKK",
"proteome": null,
"gene": "glmU",
"go_terms": [
{
"identifier": "GO:0003977",
"name": "UDP-N-acetylglucosamine diphosphorylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019134",
"name": "glucosamine-1-phosphate N-acetyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006048",
"name": "UDP-N-acetylglucosamine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000902",
"name": "cell morphogenesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009252",
"name": "peptidoglycan biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016740",
"name": "transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "83b93763baac4962d7f2722eb280b289b7c464e5",
"counters": {
"domain_architectures": 2254,
"entries": 21,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"cdd": 2,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"prosite": 1,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2254
}
}
}