"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F8ES46"	"{'domain_architectures': 2254, 'entries': 21, 'isoforms': 0, 'proteomes': 0, 'sets': 4, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'pfam': 2, 'cdd': 2, 'ncbifam': 2, 'hamap': 1, 'panther': 1, 'prosite': 1, 'interpro': 8}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 2254}"	"['Catalyzes the last two sequential reactions in the de novo biosynthetic pathway for UDP-N-acetylglucosamine (UDP-GlcNAc). The C-terminal domain catalyzes the transfer of acetyl group from acetyl coenzyme A to glucosamine-1-phosphate (GlcN-1-P) to produce N-acetylglucosamine-1-phosphate (GlcNAc-1-P), which is converted into UDP-GlcNAc by the transfer of uridine 5-monophosphate (from uridine 5-triphosphate), a reaction catalyzed by the N-terminal domain']"	"glmU"	"[{'identifier': 'GO:0003977', 'name': 'UDP-N-acetylglucosamine diphosphorylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019134', 'name': 'glucosamine-1-phosphate N-acetyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006048', 'name': 'UDP-N-acetylglucosamine biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0000287', 'name': 'magnesium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000902', 'name': 'cell morphogenesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009252', 'name': 'peptidoglycan biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016740', 'name': 'transferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"F8ES46_ZYMMT"	"83b93763baac4962d7f2722eb280b289b7c464e5"	True	False	False	454	"Bifunctional protein GlmU"	3	""	"MTTHKPFSAVILAAGKGTRMRSDIHKILHPLAGRPLLGWVLETIAPLEPVYTILVTGSGRNQVERYLEKMSLSVTPVTQNEQLGTAHAVNQAKSALEEFKGDIVILYGDVPLVQPKTIQHLLSRLHQADKPKVAVLAFRPDDPRQYGRILTGENNHIVKMVEYKDANPKERQINLCNSGLLAIRSADLWPLLDRVKNNNAAGEYYLPDIVMLALVDGDVAVTVEAEAWEVTGVNNRSELAQLETVWQTRKRTRVMEEGASLVAPETVWFSYDTKIGRDVTIEPQVFFGPEVKIGDGVTIHAFSHIEGAEVAEKAEIGPFARLRPGADIAEKAKVGNFVEIKKAKVEKGAKVNHLTYIGDASIGAGANIGGGTITCNYDGFGKYRTEIGENAFIGSNSALVAPVRIGAGAIIAAGSIVTCNVPDDALAIARGRQENKSLWAKAFRAHKSKDKAKK"	"unreviewed"	"{'taxId': '579138', 'scientificName': 'Zymomonas mobilis subsp. pomaceae (strain ATCC 29192 / DSM 22645 / JCM 10191 / CCUG 17912 / NBRC 13757 / NCIMB 11200 / NRRL B-4491 / Barker I)', 'fullName': 'Zymomonas mobilis subsp. pomaceae (strain ATCC 29192 / DSM 22645 / JCM 10191 / CCUG 17912 / NBRC 13757 / NCIMB 11200 / NRRL B-4491 / Barker I)'}"
