General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F7XMR7",
        "id": "F7XMR7_METZD",
        "source_organism": {
            "taxId": "679901",
            "scientificName": "Methanosalsum zhilinae (strain DSM 4017 / NBRC 107636 / OCM 62 / WeN5)",
            "fullName": "Methanosalsum zhilinae (strain DSM 4017 / NBRC 107636 / OCM 62 / WeN5)"
        },
        "name": "Ferredoxin",
        "description": [
            "Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions"
        ],
        "length": 76,
        "sequence": "MADKADKVPENVPGPYYVDEECIACGICIETAPENFKMNEDGSKAYVYRQPETDEEIDTCEDALAECPVDAIGNDG",
        "proteome": "UP000006622",
        "gene": "Mzhil_1238",
        "go_terms": [
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e3b8dbe53d7db47c402d67a1feca844b1de7d7a3",
        "counters": {
            "domain_architectures": 12404,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12404
        }
    }
}