"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F7XMR7"	"{'domain_architectures': 12404, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'panther': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 12404}"	"['Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions']"	"Mzhil_1238"	"[{'identifier': 'GO:0005506', 'name': 'iron ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"F7XMR7_METZD"	"e3b8dbe53d7db47c402d67a1feca844b1de7d7a3"	True	False	False	76	"Ferredoxin"	4	"UP000006622"	"MADKADKVPENVPGPYYVDEECIACGICIETAPENFKMNEDGSKAYVYRQPETDEEIDTCEDALAECPVDAIGNDG"	"unreviewed"	"{'taxId': '679901', 'scientificName': 'Methanosalsum zhilinae (strain DSM 4017 / NBRC 107636 / OCM 62 / WeN5)', 'fullName': 'Methanosalsum zhilinae (strain DSM 4017 / NBRC 107636 / OCM 62 / WeN5)'}"