GET /api/protein/UniProt/F7IR44/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F7IR44",
"id": "F7IR44_CALJA",
"source_organism": {
"taxId": "9483",
"scientificName": "Callithrix jacchus",
"fullName": "Callithrix jacchus (White-tufted-ear marmoset)"
},
"name": "C-type lectin domain family 1 member B",
"description": [
"C-type lectin-like receptor that functions as a platelet receptor for the lymphatic endothelial marker, PDPN. After ligand activation, signals via sequential activation of SRC and SYK tyrosine kinases leading to activation of PLCG2"
],
"length": 229,
"sequence": "MQDEDGYITLNIKTRKPSLISVGHASSSWWRVMALILLILCVGMVIGLVALGIWSAVQQNYLQDENENLSAALQQLAKRFCQYVIKQAEQKGTFKDHKCSPCDTNWRYYGGSCYGFFKHNLTWEESKQYCIDMNSTLLKIDNQNVQEYIKARTRLIRWVGLSRQKSDEVWKWEDGSVLSQNMFELLEDGKENMNCAYFHNGKMHPTFCENKHYLMCERKAGKANVDQLP",
"proteome": "UP000008225",
"gene": "CLEC1B",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1cc9d00484b728ff431ced75fc3bb394a7e71b41",
"counters": {
"domain_architectures": 71987,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"cdd": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 71987
}
}
}