"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F7IR44"	"{'domain_architectures': 71987, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'cdd': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 71987}"	"['C-type lectin-like receptor that functions as a platelet receptor for the lymphatic endothelial marker, PDPN. After ligand activation, signals via sequential activation of SRC and SYK tyrosine kinases leading to activation of PLCG2']"	"CLEC1B"	""	"F7IR44_CALJA"	"1cc9d00484b728ff431ced75fc3bb394a7e71b41"	True	False	False	229	"C-type lectin domain family 1 member B"	4	"UP000008225"	"MQDEDGYITLNIKTRKPSLISVGHASSSWWRVMALILLILCVGMVIGLVALGIWSAVQQNYLQDENENLSAALQQLAKRFCQYVIKQAEQKGTFKDHKCSPCDTNWRYYGGSCYGFFKHNLTWEESKQYCIDMNSTLLKIDNQNVQEYIKARTRLIRWVGLSRQKSDEVWKWEDGSVLSQNMFELLEDGKENMNCAYFHNGKMHPTFCENKHYLMCERKAGKANVDQLP"	"unreviewed"	"{'taxId': '9483', 'scientificName': 'Callithrix jacchus', 'fullName': 'Callithrix jacchus (White-tufted-ear marmoset)'}"