GET /api/protein/UniProt/F7E5Z4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F7E5Z4",
"id": "F7E5Z4_XENTR",
"source_organism": {
"taxId": "8364",
"scientificName": "Xenopus tropicalis",
"fullName": "Xenopus tropicalis (Western clawed frog)"
},
"name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha",
"description": [
"Essential subunit of both the farnesyltransferase and the geranylgeranyltransferase complex. Contributes to the transfer of a farnesyl or geranylgeranyl moiety from farnesyl or geranylgeranyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. May positively regulate neuromuscular junction development downstream of MUSK via its function in RAC1 prenylation and activation"
],
"length": 379,
"sequence": "MLAPGAEEEGGEPEVQVMSQEQGEWECEQKVPSAPEMDGAGDSDLDYESLLASDRYILYRDRKEWADVKPVPQDDGPNPVVQIVYSEKFRDVYDYFRAVLQSDEKSERAFKLTTDAIELNAANYTVWHYRRVLLSSLQKDLREEMNYITAIIEEQPKNYQVWHHRRVLVELLKDPSEELEFTAEILSQDAKNYHAWQHRQWVIQEFNLWDNELQYVDLLLARDLRNNSAWNQRHFVISSTSGYSNSTILDREVQYALEMIKVAPHNESAWNYLRGILQERGMSEYPRLLDQIQCLQQTHSSPYLYAFLVDIYEDMLEKKCQNVEDTLNRALELCEILAKEKDTIRKEYWRYIGRSLTVKYGVNHTEKEEPINMDTVQPE",
"proteome": "UP000008143",
"gene": "fnta",
"go_terms": [
{
"identifier": "GO:0008318",
"name": "protein prenyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0018342",
"name": "protein prenylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "26c858381acf809095f09e0223ab2e3de9465ba6",
"counters": {
"domain_architectures": 4415,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4415
}
}
}