GET /api/protein/UniProt/F7E5Z4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F7E5Z4",
        "id": "F7E5Z4_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha",
        "description": [
            "Essential subunit of both the farnesyltransferase and the geranylgeranyltransferase complex. Contributes to the transfer of a farnesyl or geranylgeranyl moiety from farnesyl or geranylgeranyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. May positively regulate neuromuscular junction development downstream of MUSK via its function in RAC1 prenylation and activation"
        ],
        "length": 379,
        "sequence": "MLAPGAEEEGGEPEVQVMSQEQGEWECEQKVPSAPEMDGAGDSDLDYESLLASDRYILYRDRKEWADVKPVPQDDGPNPVVQIVYSEKFRDVYDYFRAVLQSDEKSERAFKLTTDAIELNAANYTVWHYRRVLLSSLQKDLREEMNYITAIIEEQPKNYQVWHHRRVLVELLKDPSEELEFTAEILSQDAKNYHAWQHRQWVIQEFNLWDNELQYVDLLLARDLRNNSAWNQRHFVISSTSGYSNSTILDREVQYALEMIKVAPHNESAWNYLRGILQERGMSEYPRLLDQIQCLQQTHSSPYLYAFLVDIYEDMLEKKCQNVEDTLNRALELCEILAKEKDTIRKEYWRYIGRSLTVKYGVNHTEKEEPINMDTVQPE",
        "proteome": "UP000008143",
        "gene": "fnta",
        "go_terms": [
            {
                "identifier": "GO:0008318",
                "name": "protein prenyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0018342",
                "name": "protein prenylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "26c858381acf809095f09e0223ab2e3de9465ba6",
        "counters": {
            "domain_architectures": 4415,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4415
        }
    }
}