GET /api/protein/UniProt/F7C8Y6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F7C8Y6",
"id": "F7C8Y6_HORSE",
"source_organism": {
"taxId": "9796",
"scientificName": "Equus caballus",
"fullName": "Equus caballus (Horse)"
},
"name": "Troponin C, slow skeletal and cardiac muscles",
"description": [
"Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments"
],
"length": 247,
"sequence": "FPRFPDPRPPPPDRGAQTPSPTPRPGLRFQPPAPAPTPATPAHRIRVHQLRAHNARLLGRLCLPLRPEAARRRRRHVPGSAAAARRRLAAAGGGVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE",
"proteome": "UP000002281",
"gene": "TNNC1",
"go_terms": [
{
"identifier": "GO:0005509",
"name": "calcium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6221f0aa6d2dc3551fc0774632a44e22f98a3949",
"counters": {
"domain_architectures": 14671,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"smart": 1,
"cdd": 1,
"pfam": 2,
"profile": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 14671
}
}
}