"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F7C8Y6"	"{'domain_architectures': 14671, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'smart': 1, 'cdd': 1, 'pfam': 2, 'profile': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 14671}"	"['Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments']"	"TNNC1"	"[{'identifier': 'GO:0005509', 'name': 'calcium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"F7C8Y6_HORSE"	"6221f0aa6d2dc3551fc0774632a44e22f98a3949"	True	False	False	247	"Troponin C, slow skeletal and cardiac muscles"	3	"UP000002281"	"FPRFPDPRPPPPDRGAQTPSPTPRPGLRFQPPAPAPTPATPAHRIRVHQLRAHNARLLGRLCLPLRPEAARRRRRHVPGSAAAARRRLAAAGGGVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE"	"unreviewed"	"{'taxId': '9796', 'scientificName': 'Equus caballus', 'fullName': 'Equus caballus (Horse)'}"