General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F7B0K1",
        "id": "F7B0K1_CALJA",
        "source_organism": {
            "taxId": "9483",
            "scientificName": "Callithrix jacchus",
            "fullName": "Callithrix jacchus (White-tufted-ear marmoset)"
        },
        "name": "Store-operated calcium entry-associated regulatory factor",
        "description": [
            "Negative regulator of store-operated Ca(2+) entry (SOCE) involved in protecting cells from Ca(2+) overfilling. In response to cytosolic Ca(2+) elevation after endoplasmic reticulum Ca(2+) refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca(2+) levels, and thus preventing the overload of the cell with excessive Ca(2+) ions"
        ],
        "length": 341,
        "sequence": "MAAACGPGTAGYCLLLGLHMFLLTAGPALGWNDPDRMLLRDVKALTLHYDRYTTSRRLDPIPQLKCVGGTAGCDSYTPKVIQCQNKGWDGYDVQWECKTDLDIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLDYTELGLKKLKESGKQHGFASFSDYYHKWYSADSCNMSGLITIVVLLGIAFVVYKLFLSDGQYSPPSYSDYSTFSPRYQRFTNPSGPPPPGFKSEFTGPQNTGRGATSGFGGAFAGQQGYENSGPGFWTGLGTGGLLGYLFGSNRAATPFSDSWYYPSYPPSYSGTWNSRAYSPLRGGSGSYSACSNSDTKTRTASGNSFGNFRR",
        "proteome": "UP000008225",
        "gene": "SARAF",
        "go_terms": [
            {
                "identifier": "GO:2001256",
                "name": "regulation of store-operated calcium entry",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005789",
                "name": "endoplasmic reticulum membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d7370caaadf6922c1aee2c98c0eaf0bbc9ee50a5",
        "counters": {
            "domain_architectures": 2885,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2885
        }
    }
}