GET /api/protein/UniProt/F6USV8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F6USV8",
"id": "F6USV8_ORNAN",
"source_organism": {
"taxId": "9258",
"scientificName": "Ornithorhynchus anatinus",
"fullName": "Ornithorhynchus anatinus (Duckbill platypus)"
},
"name": "Guanine nucleotide exchange factor MSS4",
"description": [
"Guanine-nucleotide-releasing protein that acts on members of the SEC4/YPT1/RAB subfamily. Stimulates GDP release from both YPT1, RAB3A and RAB10, but is less active on these proteins than on the SEC4 protein. Might play a general role in vesicular transport"
],
"length": 143,
"sequence": "MEEAAAAAAAAAAGEEEEEEAAAAGRERELVSADGRNRKAVLCQRCGSRVLLPGAALFSQRQLFLPSMRKKPALVDGSDPDGDLLQDHWLVDDMFSFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKKSFYVALERVSHE",
"proteome": "UP000002279",
"gene": "RABIF",
"go_terms": [
{
"identifier": "GO:0005085",
"name": "guanyl-nucleotide exchange factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007264",
"name": "small GTPase-mediated signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1fabeff0acd708811406ecda84dce44467fa77a0",
"counters": {
"domain_architectures": 1736,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1736
}
}
}