"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F6USV8"	"{'domain_architectures': 1736, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1736}"	"['Guanine-nucleotide-releasing protein that acts on members of the SEC4/YPT1/RAB subfamily. Stimulates GDP release from both YPT1, RAB3A and RAB10, but is less active on these proteins than on the SEC4 protein. Might play a general role in vesicular transport']"	"RABIF"	"[{'identifier': 'GO:0005085', 'name': 'guanyl-nucleotide exchange factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0007264', 'name': 'small GTPase-mediated signal transduction', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"F6USV8_ORNAN"	"1fabeff0acd708811406ecda84dce44467fa77a0"	True	False	False	143	"Guanine nucleotide exchange factor MSS4"	4	"UP000002279"	"MEEAAAAAAAAAAGEEEEEEAAAAGRERELVSADGRNRKAVLCQRCGSRVLLPGAALFSQRQLFLPSMRKKPALVDGSDPDGDLLQDHWLVDDMFSFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKKSFYVALERVSHE"	"unreviewed"	"{'taxId': '9258', 'scientificName': 'Ornithorhynchus anatinus', 'fullName': 'Ornithorhynchus anatinus (Duckbill platypus)'}"
