General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F6TPM0",
        "id": "F6TPM0_ORNAN",
        "source_organism": {
            "taxId": "9258",
            "scientificName": "Ornithorhynchus anatinus",
            "fullName": "Ornithorhynchus anatinus (Duckbill platypus)"
        },
        "name": "E3 ubiquitin-protein ligase RNFT1",
        "description": [
            "E3 ubiquitin-protein ligase that acts in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway, which targets misfolded proteins that accumulate in the endoplasmic reticulum (ER) for ubiquitination and subsequent proteasome-mediated degradation. Protects cells from ER stress-induced apoptosis"
        ],
        "length": 399,
        "sequence": "MQASYSHLHNPSGTGGGEAASASQCTHVPRLTGEGACHHTGDVHIQINSVPGEGGENSSSRYTRSSSQSCSHGRVHSRARGHSHNEARQPDEASVDSGEHGNSSISEFRYLFQWLQKSLPYILILCFKVVVQHITGISLGIGLLTTFMYANKSIVNQVFLREKCSKIQCAWLLVFLTGSSVLLYYTFHSQTLYHSLIFLNPSLDFLNFWDVLWIVGITDFILKFLFMGFKCLILLVPSFVMSFKSKGYWYMLLEELCQYYRTFVPIPVWFRYLVSYGELDSAAGWSLGVLLGLLYLILKLLDFFGHLRTFRRVLKTFFTQPNYGVTASKRQCSEADDLCSICQAEFQKPILLICQHIFCEECISLWFTRERTCPLCRTVISDHVSKWKDGATSSHLQIY",
        "proteome": "UP000002279",
        "gene": "RNFT1",
        "go_terms": [
            {
                "identifier": "GO:0061630",
                "name": "ubiquitin protein ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:1904294",
                "name": "positive regulation of ERAD pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "12d1433dab545f19dde570dfa64f329161db0550",
        "counters": {
            "domain_architectures": 151903,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "smart": 1,
                "profile": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 151903
        }
    }
}