GET /api/protein/UniProt/F6TPM0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F6TPM0",
"id": "F6TPM0_ORNAN",
"source_organism": {
"taxId": "9258",
"scientificName": "Ornithorhynchus anatinus",
"fullName": "Ornithorhynchus anatinus (Duckbill platypus)"
},
"name": "E3 ubiquitin-protein ligase RNFT1",
"description": [
"E3 ubiquitin-protein ligase that acts in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway, which targets misfolded proteins that accumulate in the endoplasmic reticulum (ER) for ubiquitination and subsequent proteasome-mediated degradation. Protects cells from ER stress-induced apoptosis"
],
"length": 399,
"sequence": "MQASYSHLHNPSGTGGGEAASASQCTHVPRLTGEGACHHTGDVHIQINSVPGEGGENSSSRYTRSSSQSCSHGRVHSRARGHSHNEARQPDEASVDSGEHGNSSISEFRYLFQWLQKSLPYILILCFKVVVQHITGISLGIGLLTTFMYANKSIVNQVFLREKCSKIQCAWLLVFLTGSSVLLYYTFHSQTLYHSLIFLNPSLDFLNFWDVLWIVGITDFILKFLFMGFKCLILLVPSFVMSFKSKGYWYMLLEELCQYYRTFVPIPVWFRYLVSYGELDSAAGWSLGVLLGLLYLILKLLDFFGHLRTFRRVLKTFFTQPNYGVTASKRQCSEADDLCSICQAEFQKPILLICQHIFCEECISLWFTRERTCPLCRTVISDHVSKWKDGATSSHLQIY",
"proteome": "UP000002279",
"gene": "RNFT1",
"go_terms": [
{
"identifier": "GO:0061630",
"name": "ubiquitin protein ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:1904294",
"name": "positive regulation of ERAD pathway",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "12d1433dab545f19dde570dfa64f329161db0550",
"counters": {
"domain_architectures": 151903,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"smart": 1,
"profile": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 151903
}
}
}